The short version of Residual moisture fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-10-03 and is reviewed periodically as new material appears.
Temperature is the most common controlled variable, but its effect is not linear. Lower temperatures reduce most chemical reaction rates, yet freezing can concentrate solutes and create pH shifts in the remaining liquid phase. Repeated freeze-thaw cycles can denature or aggregate some peptides, especially those with hydrophobic segments. For lyophilized powders, desiccation and protection from moisture are often more important than deep freezing. For solutions, the choice between refrigeration and freezing depends on peptide concentration, buffer components, and the intended duration of storage.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, conformation, and the surrounding matrix. In the solid state, lyophilized powders are generally more stable than solutions because low water activity slows hydrolysis and oxidation. Residual moisture, oxygen, trace metals, and light can still promote degradation over time. Storage recommendations therefore balance temperature, humidity, and container integrity rather than relying on a single condition. The optimal condition for a given peptide is often determined empirically because no universal rule covers every sequence.
Aseptic technique reduces microbial and particulate contamination when a peptide solution will be used in cell culture or other sensitive applications. Work in a clean area, use sterile containers and filtered tips, and avoid touching vial interiors. Preparing aliquots immediately after dissolution limits repeated temperature cycling, which is a common cause of aggregation and activity loss. Low-binding plastic tubes are preferred for peptides that adsorb to surfaces, especially hydrophobic or positively charged sequences. Labels should record identity, solvent, concentration, and preparation date so that later use can be traced.
Shipping and short-term transfer require attention to temperature control and physical stability. Frozen solutions are commonly sent on dry ice, while lyophilized powders may travel with gel packs or insulated packaging. Thawing should be done slowly on ice or in a refrigerator, not by vigorous heating, and the solution should be mixed gently before use. Temperature loggers can document excursions during transit, but their presence does not prove that a peptide remained stable. Analytical checks such as chromatography or mass spectrometry can verify identity and purity after storage or shipping.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized solid; may appear fluffy or crystalline |
| Solubility class | Water-soluble or sparingly soluble | Depends on sequence and counter-ion content |
| Typical storage temperature | -20 °C or lower for solids | Refrigeration may suffice for short-term use |
| Common analytical method | Reverse-phase HPLC | Purity and degradation products are often assessed by UV detection |
| Primary stability risks | Moisture, oxygen, light, heat | Aggregation and hydrolysis can also occur in solution |
Light exposure can damage aromatic residues and certain labels, so amber vials or opaque containers are often used. pH control matters in solution, as extreme acidity or alkalinity accelerates backbone cleavage; buffers may also introduce ions that affect solubility. Microbial growth is a concern for aqueous preparations that lack preservatives, though many research peptides are handled in sterile or low-bioburden conditions. Container materials can adsorb peptides, particularly hydrophobic or positively charged sequences, reducing recovery. These factors interact, meaning storage decisions balance chemical stability, physical state, and intended use.
Peptides are short chains of amino acids whose physical and chemical stability depends on sequence, length, and conformation. The amide backbone can hydrolyze under acidic or basic conditions, while side chains such as methionine, cysteine, and tryptophan are prone to oxidation. Aggregation may occur when hydrophobic regions associate, especially near surfaces or at high concentration. Because these pathways differ among peptides, no single storage condition applies to all sequences. Stability studies therefore examine each peptide under defined temperature, pH, and humidity ranges.
Container and environment choices matter. Peptides may adsorb to glass, plastic, or filter membranes, especially at low concentrations. Low-binding tubes and inert containers reduce loss. Moisture barriers include sealed bags with desiccant, and light protection uses amber vials or opaque wraps. Inert gas blankets can limit oxidation for sequences containing methionine, cysteine, or tryptophan. Buffers and pH also affect solution stability; extremes of pH accelerate hydrolysis and deamidation. These practices apply to research and manufacturing settings, not to any specific clinical use.
Peptides are short amino acid polymers whose stability depends on sequence, length, and chemical modifications. In dry form, most peptides are relatively stable because low water activity slows hydrolysis and other degradation. Residual moisture, oxygen, and light can still promote oxidation, deamidation, or aggregation over time. Storage recommendations therefore usually combine low temperature, desiccation, and protection from light. Because each peptide has distinct properties, no single condition fits every sequence.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Combination of TMA-2 with harmaline or ibogaine has been reported to result in long-lasting episodes complicated by severe psychomotor agitation. TMA-2's affinity (Ki) for the serotonin 5-HT2A receptor has been found to be 1,300 nM. Its EC50Tooltip half-maximal effective concentration at the receptor was 190 nM and its EmaxTooltip maximal efficacy was 84%. The drug was also active at the serotonin 5-HT2B receptor and, to a much lesser extent, at the serotonin 5-HT2C receptor. In an earlier study, its affinities (Ki) were 1,650 nM at the serotonin 5-HT2 receptor and 46,400 nM at the serotonin 5-HT1 receptor. TMA-2 is inactive at the monoamine transporters. It was inactive at the mouse trace amine-associated receptor 1 (TAAR1), whereas it bound to the rat TAAR1 with an affinity (Ki) of 3,100 nM and was not assessed at the human TAAR1. In terms of metabolism, TMA-2 is known to be at least partially O-demethylated in animals in vivo. It might produce 2,4,5-trihydroxyamphetamine (THA) as a metabolite. The pharmacokinetics and metabolism of TMA-2 in humans are unknown.
Sources: en.wikipedia.org
Most class III adenylyl cyclases are transmembrane proteins with 12 transmembrane segments. The protein is organized with 6 transmembrane segments, then the C1 cytoplasmic domain, then another 6 membrane segments, and then a second cytoplasmic domain called C2. The important parts for function are the N-terminus and the C1 and C2 regions. The C1a and C2a subdomains are homologous and form an intramolecular 'dimer' that forms the active site. In Mycobacterium tuberculosis and many other bacterial cases, the AC-III polypeptide is only half as long, comprising one 6-transmembrane domain followed by a cytoplasmic domain, but two of these form a functional homodimer that resembles the mammalian architecture with two active sites. In non-animal class III ACs, the catalytic cytoplasmic domain is seen associated with other (not necessarily transmembrane) domains. Class III adenylyl cyclase domains can be further divided into four subfamilies, termed class IIIa through IIId. Animal membrane-bound ACs belong to class IIIa.
The Bergmann degradation makes use of the azide degradation described by the Curtius rearrangement. Curtius also attempted to degrade benzoylated amino acids; however, his method involved splitting the carbamate with strongly energetic treatment with acids, which lead to decomposition of the resultant aldehyde and acid amides. This convinced Bergmann that Curtius' azide degradation could be followed by treatment with benzyl alcohol (his carbobenzoxy method) to isolate the resultant amino acid aldehyde and residual peptide amide for sequencing purposes.
25499Es + 4820Ca → 302119Uue* → no atoms It is highly unlikely that this reaction will be able to create any atoms of ununennium in the near future, given the extremely difficult task of making sufficient amounts of einsteinium-254, which is favoured for production of ultraheavy elements because of its large mass, relatively long half-life of 270 days, and availability in significant amounts of several micrograms, to make a large enough target to increase the sensitivity of the experiment to the required level; einsteinium has not been found in nature and has only been produced in laboratories, and in quantities smaller than those needed for effective synthesis of superheavy elements. However, given that ununennium is only the first period 8 element on the extended periodic table, it may well be discovered in the near future through other reactions, and indeed an attempt to synthesise it is currently ongoing in Japan. Currently, none of the period 8 elements has been discovered yet, and it is also possible, due to drip instabilities, that only the lower period 8 elements, up to around element 128, are physically possible. No attempts at synthesis have been made for any heavier alkali metals: due to their extremely high atomic number, they would require new, more powerful methods and technology to make.
Aspartate has many other biochemical roles. It is a metabolite in the urea cycle and participates in gluconeogenesis. It carries reducing equivalents in the malate-aspartate shuttle, which utilizes the ready interconversion of aspartate and oxaloacetate, which is the oxidized (dehydrogenated) derivative of malic acid. Aspartate donates one nitrogen atom in the biosynthesis of inosine, the precursor to the purine bases. In addition, aspartic acid acts as a hydrogen acceptor in a chain of ATP synthase. Dietary L-aspartic acid has been shown to act as an inhibitor of Beta-glucuronidase, which serves to regulate enterohepatic circulation of bilirubin and bile acids. Click on genes, proteins and metabolites below to link to respective articles. Aspartate (the conjugate base of aspartic acid) stimulates NMDA receptors, though not as strongly as the amino acid neurotransmitter L-glutamate does. Aspartate is the "A" in NMDA (N-methyl-D-aspartate receptor).
2,4,6-Triisopropylbenzenesulfonyl azide (trisyl azide) is an organic chemical used as a reagent to supply azide for electrophilic amination reactions, such as for the asymmetric synthesis of unnatural amino acids. Introduction of an azide on the α carbon of carboxylic acid derivatives using trisyl azide is an efficient alternative to electrophilic halogenation followed by nucleophilic substitution using anionic azide. Using an oxazolidinone as chiral auxiliary typically gives good induction of the stereochemistry at the α position. Subsequent reduction converts the α-azide to an α-amine.
Sources: en.wikipedia.org
Adesuwa Obasuyi (born February 1990) is a Nigerian environmentalist, climate change advocate, and the initiator of Sustainable Africa Cities and Communities Initiative - an environmental non-governmental organization that focuses on waste, and waste data management in Nigeria and Africa. She currently works as the Climate Change Policy Manager at the British High Commission, Abuja. She attended Delta State University, and obtained a bachelor's degree in Biochemistry in 2010; she went further to get a master's degree in Environmental Quality Management(2014 - 2017) from the University of Benin.
Autosomal-dominant mutations in APP cause hereditary early-onset Alzheimer's disease (familial AD, fAD). This form of AD accounts for no more than 10% of all cases, and the vast majority of AD is not accompanied by such mutations. However, familial Alzheimer's disease is likely to result from altered proteolytic processing. This is evidenced by the fact that many mutations that lead to fAD occur near γ-secretase cleavage sites on APP. One of the most common mutations causing fAD, London Mutation, occurs at codon 717 of the APP gene, and results in a valine to isoleucine amino acid substitution. Histochemical analysis of the APP V717I mutation has revealed extensive Aβ pathology throughout neuroaxis as well as widespread cerebral amyloid angiopathy (CAA). The gene for the amyloid precursor protein is located on chromosome 21, and accordingly people with Down syndrome have a very high incidence of Alzheimer's disease.
While AM could be an important biomarker for bacterial infections like sepsis, AM has diminished value in its utility for cardiovascular diseases (CVD), attributable to its minimal increase in these conditions and reduced half-life. AM is associated with controlling vascular integrity, blood pressure, and general cardiovascular function. Since AM has been noted for its exacerbated levels in intense diseases with an elevated concern for mortality, AM could still have some value as a predictive biomarker of harmful clinical consequences for an array of cardiovascular illnesses. AM has conservatory effects against arteriosclerosis and vascular harm. Extended AM administration or hyper-expression of its target gene in rodent model organisms diminishes vascular hyperplasia, fatty streak construction, and intimal expansion. AM also has angiogenic characteristics, leading to organ and tissue maintenance by reducing the risk of ischemic diseases. AM binds to particular receptors like calcitonin gene-related peptide (CGRP) receptors, which affects the cardiovascular system by contributing to vasodilation as well as elevated heart rate and blood pressure.
The AToFMS allows for the determination of mixing state, or distribution of chemical species, within individual particles. These mixing states are important in the determination of climate and health impact of aerosols. The schematic of a typical AToFMS is shown to the right. The overall structure of ATOF instruments is; sampling, sizing, and the mass analyzer region. The inlet system is similar to the AMS by using the same aerodynamic focusing lens, but it has smaller orifices because of its analysis of single particles. In the sizing region particle passes through the first continuous solid state laser that generates an initial pulse of scattered light. Then the particle passes through the second laser that is orthogonal to the first and produces a pulse of scattered light. The light is detected by a photomultiplier (PMT) that is matched up to each laser. Using the transit times between the two detected pulses and the fixed distance the velocity and size of each particle is calculated. Next the particles travel through to the mass analyzer region where it is ionized by a pulsed LDI laser, which is timed to hit the particle as it reaches the center of the ion extraction region. Once ionized, the positive ions are accelerated towards the positive ToF section and the negative ions are accelerated towards the negative ToF section where they are detected.
Affinity chromatography can be used in a number of applications, including nucleic acid purification, protein purification from cell free extracts, and purification from blood. By using affinity chromatography, one can separate proteins that bind to a certain fragment from proteins that do not bind that specific fragment. Because this technique of purification relies on the biological properties of the protein needed, it is a useful technique and proteins can be purified many folds in one step.
Sources: en.wikipedia.org
Lyophilized peptides have low water activity, which slows hydrolysis and many oxidative pathways. Low temperatures further reduce residual chemical reactivity and microbial growth risk. The exact temperature depends on peptide stability data and expected storage duration.
Common pathways include hydrolysis, oxidation, deamidation, and aggregation. Their rates depend on pH, moisture, oxygen, trace metals, light, and temperature. Container surfaces and air-liquid interfaces can also promote loss or structural change.
No. Freezing can concentrate salts and buffer species, cause pH shifts, and damage peptides during ice crystal formation. Repeated freeze-thaw cycles are particularly disruptive. Refrigeration or single-use aliquots may be preferable for some solutions.
Multiple freezing and thawing events can cause aggregation, precipitation, or loss of soluble peptide. Dividing a solution into single-use aliquots before freezing reduces this risk. If multiple cycles are unavoidable, stability should be checked after thawing.